Keratin 75 anticorps (Middle Region)

N° du produit ABIN631612

Cet anticorps Lapin Polyclonal détecte spécifiquement Keratin 75 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Keratin 75 anticorps (Middle Region) (ABIN631612)

Antigène: Keratin 75 (KRT75)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Keratin 75 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Keratin 75 anticorps

Épitope: Middle Region

Specificité: Cytokeratin 75 antibody was raised against the middle region of KRT75

Purification: Affinity purified

Immunogène: Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 75 Blocking Peptide, (ABIN5613109), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 75 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Keratin 75

Antigène: Keratin 75 (KRT75)

Autre désignation: Cytokeratin 75

Sujet: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells.

Poids moléculaire: 59 kDa (MW of target protein)